General Information

  • ID:  hor006194
  • Uniprot ID:  P33718
  • Protein name:  Bombyxin A-1 homolog A chain
  • Gene name:  SBXA1
  • Organism:  Samia cynthia (Ailanthus silkmoth) (Phalaena cynthia)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Samia (genus), Attacini (tribe), Saturniinae (subfamily), Saturniidae (family), Bombycoidea (superfamily), Obtectomera , Ditrysia , Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0008083 growth factor activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QGIAEECCNKPCTENELLGYC
  • Length:  21(79-99)
  • Propeptide:  MKTQVLFLVFALAAVMVSGDATPHVYCGRRLATMLSFVCDNQYQVKRTPYISPENEGYGWRWLEPQRARQLDGARGKRQGIAEECCNKPCTENELLGYC
  • Signal peptide:  MKTQVLFLVFALAAVMVSG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45850
  • Structure ID:  AF-P33718-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006194_AF2.pdbhor006194_ESM.pdb

Physical Information

Mass: 267454 Formula: C94H149N25O35S4
Absent amino acids: DFHMRSVW Common amino acids: CE
pI: 3.82 Basic residues: 1
Polar residues: 10 Hydrophobic residues: 4
Hydrophobicity: -42.38 Boman Index: -3075
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 60.48
Instability Index: 6667.62 Extinction Coefficient cystines: 1740
Absorbance 280nm: 87

Literature

  • PubMed ID:  1601275
  • Title:  Structure and expression of bombyxin-related peptide genes of the moth Samia cynthia ricini.